CacheBy
Atlas Antibodies Anti-TAF6L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TAF6L Antibody

상품 한눈에 보기

TAF6L 단백질을 인식하는 사람 유래 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, 토끼에서 생산된 IgG 형식. PrEST 항원을 이용해 친화 정제되었으며, 인간, 쥐, 생쥐에서 높은 종간 반응성을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067239-100 Anti-TAF6L Antibody, TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067239-25 Anti-TAF6L Antibody, TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TAF6L Antibody

Anti-TAF6L Antibody

Target: TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TAF6L.

Alternative Gene Names

  • PAF65A

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Target Gene TAF6L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000019419 (96%)
  • Mouse ENSMUSG00000003680 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.