CacheBy
Atlas Antibodies Anti-TAF1A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TAF1A Antibody

상품 한눈에 보기

TAF1A 단백질을 인식하는 사람 유래 폴리클로날 항체로, IHC 및 ICC 응용에 적합. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, TBP 관련 인자 연구에 유용.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054334-100 Anti-TAF1A Antibody, TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054334-25 Anti-TAF1A Antibody, TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TAF1A Antibody

Anti-TAF1A Antibody

Target: TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TAF1A.

Alternative Gene Names

  • SL1
  • TAFI48

Open Datasheet

Target Information

항목 내용
Target Protein TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa
Target Gene TAF1A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence HQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEILFYHPKSNMESFNTFANRMKNIGVMNYLKISLQHALYLLHHGMLKDAKRNLSE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000072258 87%
Rat ENSRNOG00000061139 84%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application Icon
ICC Application Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.