CacheBy
Atlas Antibodies Anti-TADA2A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TADA2A Antibody

상품 한눈에 보기

Human TADA2A 단백질을 인식하는 폴리클로날 항체로, 전사 보조인자 연구에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, Rat 및 Mouse와 높은 서열 유사성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA076497-100 Anti-TADA2A Antibody, transcriptional adaptor 2A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076497-25 Anti-TADA2A Antibody, transcriptional adaptor 2A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TADA2A Antibody

Anti-TADA2A Antibody

Target Protein: transcriptional adaptor 2A
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against human TADA2A (transcriptional adaptor 2A).
Recommended for use in immunocytochemistry and related applications.

Alternative Gene Names

ADA2, ADA2A, hADA2, TADA2L

Open Datasheet (PDF)

Antigen Information

  • Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSD

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000002757): 99%
  • Mouse (ENSMUSG00000018651): 97%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.