CacheBy
Atlas Antibodies Anti-SZT2 Antibody
원본

Atlas Antibodies Anti-SZT2 Antibody

상품 한눈에 보기

인간 SZT2 단백질에 대한 폴리클로날 항체로, Rabbit 호스트에서 생산됨. IHC 등 다양한 연구 응용에 적합. 고순도 Affinity 정제 방식 사용. 인간에 특이적이며 Mouse, Rat과 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029012-100 Anti-SZT2 Antibody, seizure threshold 2 homolog (mouse) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029012-25 Anti-SZT2 Antibody, seizure threshold 2 homolog (mouse) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SZT2 Antibody

Anti-SZT2 Antibody

Target: Seizure threshold 2 homolog (mouse)
Supplier: Atlas Antibodies


면역조직화학(IHC)


Product Description

Polyclonal antibody against Human SZT2 protein.


Alternative Gene Names

C1orf84, FLJ10387, FLJ34502, KIAA0467, RP11-506B15.1, SZT2A, SZT2B

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Seizure threshold 2 homolog (mouse)
Target Gene SZT2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse: 72%, Rat: 71%

Antigen Sequence:

FTSLSVGLPETLKPLISAQPPQWRCYARLVNPQHVFLTFLPATFSDVQRLAACGLEGPPQEETKPKFGDWSG

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.