CacheBy
Atlas Antibodies Anti-SYVN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SYVN1 Antibody

상품 한눈에 보기

Human SYVN1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC에 적합하며, RNA-seq 데이터 기반의 정합 검증 완료. 고순도 친화정제 제품으로 다양한 조직에서 SYVN1 발현 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA005480-100 Anti-SYVN1 Antibody, synovial apoptosis inhibitor 1, synoviolin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005480-25 Anti-SYVN1 Antibody, synovial apoptosis inhibitor 1, synoviolin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SYVN1 Antibody

Anti-SYVN1 Antibody

Target: synovial apoptosis inhibitor 1 (synoviolin)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC compared to RNA-seq data in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human SYVN1.


Alternative Gene Names

  • DER3
  • HRD1

Target Information

항목 내용
Target Protein synovial apoptosis inhibitor 1, synoviolin
Target Gene SYVN1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGT

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000024807 92%
Rat ENSRNOG00000020950 90%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.