CacheBy
Atlas Antibodies Anti-SYTL3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SYTL3 Antibody

상품 한눈에 보기

Human SYTL3 단백질을 인식하는 Rabbit Polyclonal 항체로, exophilin-6(SLP3)로도 알려진 synaptotagmin-like 3 단백질 검출에 사용됩니다. Affinity purification 방식으로 정제되었으며 IHC 등 다양한 응용에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030585-100 Anti-SYTL3 Antibody, synaptotagmin-like 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030585-25 Anti-SYTL3 Antibody, synaptotagmin-like 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SYTL3 Antibody

Anti-SYTL3 Antibody

Target: synaptotagmin-like 3 (SYTL3)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human SYTL3 (synaptotagmin-like 3).
Also known as exophilin-6 or SLP3.

Open Datasheet


Antigen Information

Antigen Sequence (PrEST):
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

ALKELEREAILQVLYRDQAVQNTEEERTRKLKTHLQHLRWKGAKNTDWEHKEKCCARCQQVLGFLLHRGAVCRGCSHRVCAQCR

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000041831 (75%)
  • Rat ENSRNOG00000018321 (75%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.