원본

Atlas Antibodies Anti-SYS1 Antibody

상품 한눈에 보기

Human SYS1 단백질을 표적으로 하는 토끼 폴리클로날 항체. 골지체 수송 단백질 연구에 적합. PrEST 항원으로 친화 정제됨. IHC 등 다양한 응용에 활용 가능. Human, Mouse, Rat에 반응성 확인.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046716-100 Anti-SYS1 Antibody, Sys1 golgi trafficking protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046716-25 Anti-SYS1 Antibody, Sys1 golgi trafficking protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human SYS1.
Recommended for applications such as immunohistochemistry (IHC).

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence:
LVDGLVRSSPSLDQMFDAEILGFSTPPGRLSM

Verified Species: Human
Ortholog Identity:
- Mouse (ENSMUSG00000090996): 97%
- Rat (ENSRNOG00000014480): 97%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes	Gently mix before use. Determine optimal concentration and conditions experimentally.