CacheBy
Atlas Antibodies Anti-SYNPR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SYNPR Antibody

상품 한눈에 보기

Human SYNPR 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 검증 완료. Recombinant expression 및 독립 항체 비교로 검증된 신뢰성 높은 제품. PrEST 항원을 사용한 친화 정제 방식.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061671-100 Anti-SYNPR Antibody, synaptoporin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061671-25 Anti-SYNPR Antibody, synaptoporin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SYNPR Antibody

Anti-SYNPR Antibody

Target Protein: synaptoporin
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot): Recombinant expression validation using target protein overexpression.

Product Description

Polyclonal Antibody against Human SYNPR.


Alternative Gene Names

MGC26651, SPO

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein synaptoporin
Target Gene SYNPR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
MEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTSFTNQI
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000008203 (94%), Mouse ENSMUSG00000056296 (88%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Validation
IHC Tooltip
WB Validation
WB Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.