CacheBy
Atlas Antibodies Anti-SYNJ2BP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SYNJ2BP Antibody

상품 한눈에 보기

Human SYNJ2BP를 타깃으로 하는 Rabbit Polyclonal Antibody. IHC, WB, ICC에 적합. PrEST 항원을 이용해 친화 정제됨. Human 및 Mouse 반응성 검증 완료. 안정한 PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000866-100 Anti-SYNJ2BP Antibody, synaptojanin 2 binding protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000866-25 Anti-SYNJ2BP Antibody, synaptojanin 2 binding protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SYNJ2BP Antibody

Anti-SYNJ2BP Antibody

Target: synaptojanin 2 binding protein
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SYNJ2BP.

Alternative Gene Names

  • Arip2

Open Datasheet

Target Information

항목 내용
Target Protein synaptojanin 2 binding protein
Target Gene SYNJ2BP
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse
Interspecies Identity Mouse ENSMUSG00000090935 (96%), Rat ENSRNOG00000006399 (95%)

Antigen Sequence

NGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEG

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.