
1 / 2
Atlas Antibodies Anti-SYNDIG1L Antibody
상품 한눈에 보기
Human SYNDIG1L 단백질을 인식하는 Rabbit Polyclonal 항체로, 신경 시냅스 분화 관련 연구에 적합. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원을 이용해 친화 정제됨. 인체, 쥐, 랫드 간 높은 보존성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SYNDIG1L Antibody
Synapse differentiation inducing 1-like (SYNDIG1L) 단백질을 인식하는 Rabbit Polyclonal 항체입니다.
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against Human SYNDIG1L.
Alternative Gene Names
- capucin
- IFITMD4
- TMEM90A
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Synapse differentiation inducing 1-like |
| Target Gene | SYNDIG1L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ESLSELQNPLLPRSPAHLHGPYPYPETPPSWSCQEKLYSYLLGGAGPAGAHQLLDPGSLQLAVEAWYRPSCLLGRDKVKE |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 일치도 |
|---|---|---|
| Rat | ENSRNOG00000027645 | 93% |
| Mouse | ENSMUSG00000071234 | 91% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자에 의해 결정되어야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SYNE2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SYNE1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SYNDIG1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SYNCRIP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SYNDIG1L Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.