
1 / 2
Atlas Antibodies Anti-SYCE2 Antibody
상품 한눈에 보기
인간 SYCE2 단백질을 인식하는 폴리클로날 항체. IHC를 통한 단백질 발현 직교 검증에 적합. 토끼 유래 IgG로, PrEST 항원을 이용한 친화 정제 방식. 인간에 반응하며 쥐와 생쥐와도 높은 상동성(81%)을 보임.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SYCE2 Antibody
Target: synaptonemal complex central element protein 2
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human SYCE2.
Alternative Gene Names
- CESC1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | synaptonemal complex central element protein 2 |
| Target Gene | SYCE2 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | IDILQKRAQELIENINKSRQKDHALMTNFRNSLKTKVSDLTEKLEERIYQIYNDHNKIIQEKLQEFTQK |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 일치도 |
|---|---|---|
| Rat | ENSRNOG00000003279 | 81% |
| Mouse | ENSMUSG00000003824 | 81% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SYAP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SYCE3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SYCE2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SYCE2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SYCE1L Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.