Atlas Antibodies Anti-SV2A Antibody

상품 한눈에 보기

인간 SV2A 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB 실험에서 RNA-seq 데이터 기반의 Orthogonal 검증을 수행함. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간에 반응하며 신경 시냅스 관련 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA007863-100 Anti-SV2A Antibody, synaptic vesicle glycoprotein 2A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA007863-25 Anti-SV2A Antibody, synaptic vesicle glycoprotein 2A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

synaptic vesicle glycoprotein 2A

IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Orthogonal Validation
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC

Polyclonal Antibody against Human SV2A

KIAA0736, SV2

항목	내용
Target Protein	synaptic vesicle glycoprotein 2A
Target Gene	SV2A
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	SDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECGHGRFQW
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000038486 (96%), Rat ENSRNOG00000021182 (96%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand