CacheBy
Atlas Antibodies Anti-SUPV3L1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SUPV3L1 Antibody

상품 한눈에 보기

Human SUPV3L1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 recombinant expression 검증 완료. Rabbit 유래 IgG로 높은 특이성과 재현성 제공. SUPV3L1 유전자 연구용으로 권장.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038380-100 Anti-SUPV3L1 Antibody, suppressor of var1, 3-like 1 (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038380-25 Anti-SUPV3L1 Antibody, suppressor of var1, 3-like 1 (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SUPV3L1 Antibody

Anti-SUPV3L1 Antibody

Target: suppressor of var1, 3-like 1 (S. cerevisiae)
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Recombinant Expression Validation): Recombinant expression validation in WB using target protein overexpression.
  • ICC: Suitable for immunocytochemistry.

Product Description

Polyclonal Antibody against Human SUPV3L1


Alternative Gene Names

  • SUV3

Target Information

항목 내용
Target Protein suppressor of var1, 3-like 1 (S. cerevisiae)
Target Gene SUPV3L1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GMGLNLSIRRIIFYSLIKPSINEKGERELEPITTSQALQIAGRAGRFSSRFKEGEVTTMNHEDLSLLKEILKRPVDPIRAAGLHPTAE
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000000392 (91%), Mouse ENSMUSG00000020079 (89%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

Additional Resources


제품 이미지

Enhanced Validation
IHC Orthogonal
WB Recombinant Expression
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.