CacheBy
Atlas Antibodies Anti-SUN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SUN1 Antibody

상품 한눈에 보기

Human SUN1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현을 비교 검증하였습니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008461-100 Anti-SUN1 Antibody, Sad1 and UNC84 domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008461-25 Anti-SUN1 Antibody, Sad1 and UNC84 domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SUN1 Antibody

Anti-SUN1 Antibody

Target: Sad1 and UNC84 domain containing 1 (SUN1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC) – Orthogonal validation using RNA-seq data comparison between high and low expression tissues
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SUN1.

Alternative Gene Names

FLJ12407, KIAA0810, UNC84A

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Sad1 and UNC84 domain containing 1
Target Gene SUN1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QLLPTVEHLQLELDQLKSELSSWRHVKTGCETVDAVQERVDVQVREMVKLLFSEDQQGGSLEQLLQRFSSQFVSKGDLQTMLRDLQLQILRNVTHHVSVTKQLPTSEAVVSAVSEAGASGITEAQARAIVNS
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000036817 (59%), Rat ENSRNOG00000001299 (58%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.