
1 / 2
Atlas Antibodies Anti-STRIP1 Antibody
상품 한눈에 보기
Human STRIP1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC와 Western blot에 적합합니다. FAM40A 등 다양한 유전자명으로도 알려진 STRIP1을 검출하며, 고순도 Affinity 정제 방식으로 제조되었습니다. PBS/glycerol buffer에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-STRIP1 Antibody
Target: Striatin Interacting Protein 1 (STRIP1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human STRIP1.
Alternative Gene Names
FAM40A, FAR11A, FLJ14743, KIAA1761
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Striatin interacting protein 1 |
| Target Gene | STRIP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VLLNIMYLIVETVHQECEGDKAEWRTMRQTFRAELGSPLYNNEPFAIMLFGMV |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000014601 (96%), Rat ENSRNOG00000018293 (96%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-STRN4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STRIP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STRIP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STRN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-STRIP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.