CacheBy
Atlas Antibodies Anti-STK17A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STK17A Antibody

상품 한눈에 보기

인간 STK17A 단백질을 인식하는 토끼 폴리클로날 항체. Western Blot 및 Immunocytochemistry에 적합. PrEST 항원으로 친화 정제됨. 40% 글리세롤 기반 완충액에 보존제로 0.02% sodium azide 포함. 인간 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018138-100 Anti-STK17A Antibody, serine/threonine kinase 17a 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018138-25 Anti-STK17A Antibody, serine/threonine kinase 17a 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STK17A Antibody

Anti-STK17A Antibody

Target Protein: Serine/threonine kinase 17a (STK17A)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human STK17A.
Alternative Gene Name: DRAK1

Open Datasheet (PDF)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:

NISQMNLSYSEEEFDVLSESAVDFIRTLLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000026094 33%
Rat ENSRNOG00000012502 33%

Buffer Composition

40% glycerol and PBS (pH 7.2)
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

WB icon
ICC icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.