CacheBy
Atlas Antibodies Anti-STAT6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STAT6 Antibody

상품 한눈에 보기

Human STAT6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 정량적 단백질 발현 검증에 사용됩니다. PrEST 항원으로 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인간 STAT6 연구 및 IL-4 신호전달 연구에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001861-100 Anti-STAT6 Antibody, signal transducer and activator of transcription 6, interleukin-4 induced 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001861-25 Anti-STAT6 Antibody, signal transducer and activator of transcription 6, interleukin-4 induced 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STAT6 Antibody

Anti-STAT6 Antibody

Signal transducer and activator of transcription 6, interleukin-4 induced


  • IHC (Orthogonal Validation)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB (Orthogonal Validation)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

  • ICC


Product Description

Polyclonal antibody against Human STAT6.


Alternative Gene Names

D12S1644, IL-4-STAT


Target Information

항목 내용
Target Protein Signal transducer and activator of transcription 6, interleukin-4 induced
Target Gene STAT6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000025023 (77%), Mouse ENSMUSG00000002147 (74%)

Antigen Sequence:

VYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLR

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


Additional Resources

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.