CacheBy
Atlas Antibodies Anti-STAT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-STAT2 Antibody

상품 한눈에 보기

Human STAT2 단백질을 표적으로 하는 Rabbit Polyclonal 항체. IHC 및 ICC 등 다양한 응용에 적합. Affinity purification으로 높은 특이성과 재현성 확보. 40% glycerol 기반 PBS buffer에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018888-100 Anti-STAT2 Antibody, signal transducer and activator of transcription 2, 113kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018888-25 Anti-STAT2 Antibody, signal transducer and activator of transcription 2, 113kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-STAT2 Antibody

Anti-STAT2 Antibody

Signal transducer and activator of transcription 2, 113kDa

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human STAT2.

Alternative Gene Names

  • STAT113

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Signal transducer and activator of transcription 2, 113kDa
Target Gene STAT2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000031081 (67%), Mouse ENSMUSG00000040033 (63%)

Antigen Sequence

DPTQLAEMIFNLLLEEKRILIQAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQAKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.