
원본
Atlas Antibodies Anti-ST7 Antibody
상품 한눈에 보기
인간 ST7 단백질을 인식하는 폴리클론 항체로 종양억제 관련 연구에 적합함. IHC, WB, ICC 등 다양한 응용 가능. 토끼 유래 IgG 항체이며 PrEST 항원으로 정제됨. 인간, 마우스, 랫트에 100% 반응성 확인.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038325-100 Anti-ST7 Antibody, suppression of tumorigenicity 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038325-25 Anti-ST7 Antibody, suppression of tumorigenicity 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ST7 Antibody
Anti-ST7 Antibody
Target Information
- Target Protein: Suppression of tumorigenicity 7
- Target Gene: ST7
- Alternative Gene Names: ETS7q, FAM4A, FAM4A1, HELG, RAY1, SEN4, TSG7
Product Description
Polyclonal antibody against human ST7.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:PQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCATAY
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000029534 (100%)
- Rat ENSRNOG00000056243 (100%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



