원본
Atlas Antibodies Anti-ST7 Antibody
상품 한눈에 보기
인간 ST7 단백질을 인식하는 폴리클론 항체로 종양억제 관련 연구에 적합함. IHC, WB, ICC 등 다양한 응용 가능. 토끼 유래 IgG 항체이며 PrEST 항원으로 정제됨. 인간, 마우스, 랫트에 100% 반응성 확인.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038325-100 Anti-ST7 Antibody, suppression of tumorigenicity 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038325-25 Anti-ST7 Antibody, suppression of tumorigenicity 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ST7 Antibody
Anti-ST7 Antibody
Target Information
- Target Protein: Suppression of tumorigenicity 7
- Target Gene: ST7
- Alternative Gene Names: ETS7q, FAM4A, FAM4A1, HELG, RAY1, SEN4, TSG7
Product Description
Polyclonal antibody against human ST7.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:PQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCATAY
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000029534 (100%)
- Rat ENSRNOG00000056243 (100%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.