CacheBy
Atlas Antibodies Anti-ST14 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ST14 Antibody

상품 한눈에 보기

Human ST14 단백질을 인식하는 토끼 폴리클로날 항체로, 종양억제 관련 연구에 적합함. IgG 아이소타입이며 PrEST 항원으로 친화정제됨. 인간 반응성이 검증되었으며 Rat 및 Mouse와 82% 동일성. PBS와 글리세롤 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047014-100 Anti-ST14 Antibody, suppression of tumorigenicity 14 (colon carcinoma) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047014-25 Anti-ST14 Antibody, suppression of tumorigenicity 14 (colon carcinoma) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ST14 Antibody

Anti-ST14 Antibody

Target Information

  • Protein: Suppression of tumorigenicity 14 (colon carcinoma)
  • Gene: ST14
  • Alternative Gene Names: HAI, MT-SP1, PRSS14, SNC19, TMPRSS14

ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human ST14.

Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVE

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000005903 (82%)
  • Mouse ENSMUSG00000031995 (82%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.