CacheBy
Atlas Antibodies Anti-SRR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SRR Antibody

상품 한눈에 보기

Human SRR(serine racemase)을 인식하는 Rabbit Polyclonal Antibody. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. ICC 등 다양한 응용에 적합하며, Human에 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007529-100 Anti-SRR Antibody, serine racemase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007529-25 Anti-SRR Antibody, serine racemase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SRR Antibody

Anti-SRR Antibody

Target Information

  • Target Protein: Serine racemase
  • Target Gene: SRR
  • Alternative Gene Names: ILV1, ISO1

Product Description

Polyclonal antibody against human SRR.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Mouse (ENSMUSG00000001323): 93%
  • Rat (ENSRNOG00000002991): 92%

Immunocytochemistry (ICC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Store at -20°C, avoid repeated freeze-thaw cycles
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.