CacheBy
Atlas Antibodies Anti-SRP68 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SRP68 Antibody

상품 한눈에 보기

Human SRP68 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 40% 글리세롤/PBS 완충액에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055617-100 Anti-SRP68 Antibody, signal recognition particle 68kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055617-25 Anti-SRP68 Antibody, signal recognition particle 68kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SRP68 Antibody

Anti-SRP68 Antibody

Overview

Polyclonal antibody against human signal recognition particle 68kDa (SRP68) protein.
Recommended for use in IHC, WB, and ICC applications.

Product Description

  • Type: Polyclonal Antibody
  • Target Protein: Signal recognition particle 68kDa
  • Target Gene: SRP68
  • Host: Rabbit
  • Isotype: IgG
  • Purification Method: Affinity purified using the PrEST antigen as affinity ligand

Open Datasheet (PDF)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    DAKTKLEAQAYTAYLSGMLRFEHQEWKAAIEAFNKCKTIYEKLASAFTEEQAVLYNQRVEEISPNIRYCAYNIGDQSAINELMQMRLRSGGTEGLLAEKLEALITQTRAKQAATMSEVEWRGRTVPVKIDKVRIFLLGLADNEAAIV

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000009351 99%
Mouse ENSMUSG00000020780 99%

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.