Atlas Antibodies Anti-SQRDL Antibody

상품 한눈에 보기

Human SQRDL 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 데이터 기반의 정교한 정합 검증(Orthogonal Validation) 수행. 고순도 친화정제 및 안정적 PBS/glycerol buffer 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041589-100 Anti-SQRDL Antibody, sulfide quinone reductase-like (yeast) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041589-25 Anti-SQRDL Antibody, sulfide quinone reductase-like (yeast) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SQRDL Antibody

Anti-SQRDL Antibody

Target: sulfide quinone reductase-like (yeast)
Type: Polyclonal antibody against Human SQRDL

Recommended Applications

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human SQRDL.

Alternative Gene Names

CGI-44

Open Datasheet

Target Information

항목	내용
Target Protein	sulfide quinone reductase-like (yeast)
Target Gene	SQRDL
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse
Interspecies Information	Rat ENSRNOG00000000172 (93%), Mouse ENSMUSG00000005803 (89%)

Antigen Sequence:

TSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWG

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)