Atlas Antibodies Anti-SPSB2 Antibody

상품 한눈에 보기

Human SPSB2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원으로 특이적 정제되었으며, 높은 종간 반응성(마우스·랫 87%)을 보입니다. 40% 글리세롤/PBS 완충액에 보존됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA055225-100 Anti-SPSB2 Antibody, splA/ryanodine receptor domain and SOCS box containing 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA055225-25 Anti-SPSB2 Antibody, splA/ryanodine receptor domain and SOCS box containing 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: splA/ryanodine receptor domain and SOCS box containing 2 (SPSB2)
Supplier: Atlas Antibodies

Polyclonal antibody against Human SPSB2.

항목	내용
Target Protein	splA/ryanodine receptor domain and SOCS box containing 2
Target Gene	SPSB2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000038451 (87%), Rat ENSRNOG00000047113 (87%)

Epitope Sequence:
MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERR

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification	Affinity purified using the PrEST antigen as affinity ligand