
1 / 2
Atlas Antibodies Anti-SPRY1 Antibody
상품 한눈에 보기
Human SPRY1 단백질을 인식하는 폴리클로날 항체로, FGF 신호 억제 관련 연구에 적합함. Rabbit 유래 IgG 형식이며, PrEST 항원을 이용해 친화 정제됨. 인체 반응성이 검증되었으며 IHC 등 다양한 응용에 사용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SPRY1 Antibody
Target: sprouty homolog 1, antagonist of FGF signaling (Drosophila)
Recommended Applications
면역조직화학(IHC) 등 다양한 응용에 적합
Product Description
Polyclonal Antibody against Human SPRY1
Alternative Gene Names
- hSPRY1
Target Information
- Protein: sprouty homolog 1, antagonist of FGF signaling (Drosophila)
- Gene: SPRY1
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSPP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Antigen Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000037211 | 77% |
| Rat | ENSRNOG00000025371 | 74% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도와 조건은 사용자가 실험 목적에 따라 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SPRY2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPRY4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPRY1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPRY1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPRY4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.