CacheBy
Atlas Antibodies Anti-SPRY1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPRY1 Antibody

상품 한눈에 보기

Human SPRY1 단백질을 인식하는 폴리클로날 항체로, FGF 신호 억제 관련 연구에 적합함. Rabbit 유래 IgG 형식이며, PrEST 항원을 이용해 친화 정제됨. 인체 반응성이 검증되었으며 IHC 등 다양한 응용에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070554-100 Anti-SPRY1 Antibody, sprouty RTK signaling antagonist 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070554-25 Anti-SPRY1 Antibody, sprouty RTK signaling antagonist 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPRY1 Antibody

Anti-SPRY1 Antibody

Target: sprouty homolog 1, antagonist of FGF signaling (Drosophila)

면역조직화학(IHC) 등 다양한 응용에 적합

Product Description

Polyclonal Antibody against Human SPRY1

Alternative Gene Names

  • hSPRY1

Open Datasheet

Target Information

  • Protein: sprouty homolog 1, antagonist of FGF signaling (Drosophila)
  • Gene: SPRY1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    PRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSPP

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Antigen Sequence Identity
Mouse ENSMUSG00000037211 77%
Rat ENSRNOG00000025371 74%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자가 실험 목적에 따라 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.