CacheBy
Atlas Antibodies Anti-SPPL2A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPPL2A Antibody

상품 한눈에 보기

Human SPPL2A 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 정량 분석에 적합합니다. RNA-seq 기반 Orthogonal 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067304-100 Anti-SPPL2A Antibody, signal peptide peptidase like 2A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067304-25 Anti-SPPL2A Antibody, signal peptide peptidase like 2A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPPL2A Antibody

Anti-SPPL2A Antibody

Signal peptide peptidase like 2A

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human SPPL2A.

Alternative Gene Names

IMP3, PSL2

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Signal peptide peptidase like 2A
Target Gene SPPL2A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLE
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000011652 (75%), Mouse ENSMUSG00000027366 (72%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.