
1 / 2
Atlas Antibodies Anti-SPN Antibody
상품 한눈에 보기
인간 SPN 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 RNA-seq 데이터 기반 Orthogonal Validation 제공. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용한 친화 정제 방식 적용. CD43, GPL115, LSN 등 대체 유전자명 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SPN Antibody
Target Protein: sialophorin
Recommended Applications:
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SPN
Alternative Gene Names
CD43, GPL115, LSN
Technical Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | sialophorin |
| Target Gene | SPN |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEG |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000036711 (65%), Mouse ENSMUSG00000051457 (65%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
| Safety | Material Safety Data Sheet |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SPINT4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPIRE2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPIRE1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPINT1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.