CacheBy
Atlas Antibodies Anti-SPIRE1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPIRE1 Antibody

상품 한눈에 보기

Human SPIRE1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. Rabbit에서 생산되었으며, PrEST 항원으로 친화 정제됨. 인체 반응성이 검증된 고품질 연구용 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040942-100 Anti-SPIRE1 Antibody, spire-type actin nucleation factor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040942-25 Anti-SPIRE1 Antibody, spire-type actin nucleation factor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPIRE1 Antibody

Anti-SPIRE1 Antibody

제품 설명

Polyclonal Antibody against Human SPIRE1
Target Protein: spire-type actin nucleation factor 1

추천 응용 분야

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

대체 유전자명

KIAA1135, spir-1

Open Datasheet

항원 정보

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
LEEIKAERKLRPVSPEEIRRSRLDVTTPESTKNLVESSMVNGGLTSQTKENGLSTSQQVPAQRKKLLRAPTLAELDSSESEEETLHK

종 반응성 검증

Verified Species Reactivity: Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000024533 (86%)
  • Rat ENSRNOG00000025324 (83%)

항체 특성

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

사용 시 주의사항

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.