CacheBy
Atlas Antibodies Anti-SPHKAP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPHKAP Antibody

상품 한눈에 보기

인간 SPHKAP 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 통한 단백질 발현 정량에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었습니다. PrEST 항원으로 친화 정제되었으며, PBS/glycerol buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048168-100 Anti-SPHKAP Antibody, SPHK1 interactor, AKAP domain containing 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048168-25 Anti-SPHKAP Antibody, SPHK1 interactor, AKAP domain containing 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPHKAP Antibody

Anti-SPHKAP Antibody

SPHK1 interactor, AKAP domain containing


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human SPHKAP


Alternative Gene Names

  • SKIP

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein SPHK1 interactor, AKAP domain containing
Target Gene SPHKAP
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence PSAKPSQWKREAVGNGRQATHYYHSEAFKGQMEKSQALYIPKDAYFSMMDKDVPSACAVAEQRSNLNPGDHEDTRNALPPRQDGEVTTGKY
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000026163 (46%), Rat ENSRNOG00000016388 (45%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.