CacheBy
Atlas Antibodies Anti-SPC24 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPC24 Antibody

상품 한눈에 보기

인간 SPC24 단백질에 대한 폴리클로날 항체로, IHC, WB, ICC 응용에 적합합니다. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원으로 친화 정제되었습니다. 높은 종 간 보존성을 보이며, 40% glycerol/PBS buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051234-100 Anti-SPC24 Antibody, SPC24, NDC80 kinetochore complex component 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051234-25 Anti-SPC24 Antibody, SPC24, NDC80 kinetochore complex component 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPC24 Antibody

Anti-SPC24 Antibody

SPC24, NDC80 kinetochore complex component

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SPC24.

Alternative Gene Names

  • FLJ90806
  • SPBC24

Open Datasheet

Target Information

항목 내용
Target Protein SPC24, NDC80 kinetochore complex component
Target Gene SPC24
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (91%), Mouse (85%)

Antigen Sequence:
ERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLV

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.