CacheBy
Atlas Antibodies Anti-SPATS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPATS2 Antibody

상품 한눈에 보기

인간 SPATS2 단백질을 인식하는 토끼 유래 폴리클로날 항체입니다. 면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038643-100 Anti-SPATS2 Antibody, spermatogenesis associated, serine-rich 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038643-25 Anti-SPATS2 Antibody, spermatogenesis associated, serine-rich 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPATS2 Antibody

Anti-SPATS2 Antibody

Target: spermatogenesis associated, serine-rich 2 (SPATS2)


면역조직화학 (IHC)


Product Description

Polyclonal antibody against human SPATS2.


Alternative Gene Names

FLJ13117, SCR59, SPATA10

Open Datasheet


Target Information

항목 내용
Target Protein spermatogenesis associated, serine-rich 2
Target Gene SPATS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000051934 (68%), Rat ENSRNOG00000052307 (68%)

Antigen Sequence:

SPPSLTSANKKNFAPGETPAAIANSSGQPYQPLREVLPGNRRGGQGYRPQGQKSNDPMNQGRHDSMGRYRN

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.