CacheBy
Atlas Antibodies Anti-SPATA5L1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPATA5L1 Antibody

상품 한눈에 보기

Human SPATA5L1 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. Human에 반응하며, glycerol-PBS buffer로 안정화됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043679-100 Anti-SPATA5L1 Antibody, spermatogenesis associated 5-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043679-25 Anti-SPATA5L1 Antibody, spermatogenesis associated 5-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPATA5L1 Antibody

Anti-SPATA5L1 Antibody

Target Protein: spermatogenesis associated 5-like 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SPATA5L1.


Alternative Gene Names

  • FLJ12286
  • MGC5347

Open Datasheet (PDF)


Antigen Information

Antigen Sequence (PrEST):
TSCHCSFVSVSGADLFSPFVGDSEKVLSQIFRQARASTPAILFLDEIDSILGARSASKTGCDVQERVLSVLLNELDGVGLKTIERRGSKSSQQEFQEV

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)


Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000000169 81%
Mouse ENSMUSG00000002763 35%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.