CacheBy
Atlas Antibodies Anti-SPATA5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPATA5 Antibody

상품 한눈에 보기

Human SPATA5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등에 적합합니다. PrEST 항원으로 친화 정제되었으며, 40% 글리세롤 PBS 완충액에 보존됩니다. 인체 생식 관련 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036450-100 Anti-SPATA5 Antibody, spermatogenesis associated 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036450-25 Anti-SPATA5 Antibody, spermatogenesis associated 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPATA5 Antibody

Anti-SPATA5 Antibody

Target Information

  • Target Protein: Spermatogenesis associated 5
  • Target Gene: SPATA5
  • Alternative Gene Names: AFG2, SPAF
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SPATA5.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    SLELSLQLSQLDLEDTQIPTSRSTPYKPIDDRITNKASDVLLDVTQSPGDGSGLMLEEVTGLKCNFESAREGNEQLT

Species Reactivity

  • Verified Species Reactivity: Human
  • Interspecies Information:
    • Rat ENSRNOG00000017462 (65%)
    • Mouse ENSMUSG00000027722 (65%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.