CacheBy
Atlas Antibodies Anti-SPATA33 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SPATA33 Antibody

상품 한눈에 보기

인간 SPATA33 단백질을 대상으로 한 폴리클로날 항체로, 정자 형성과 관련된 단백질 연구에 적합합니다. IHC 및 WB 검증 완료. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간 반응성 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045648-100 Anti-SPATA33 Antibody, spermatogenesis associated 33 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045648-25 Anti-SPATA33 Antibody, spermatogenesis associated 33 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SPATA33 Antibody

Anti-SPATA33 Antibody

Target: spermatogenesis associated 33 (SPATA33)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Recombinant expression validation): Validation using target protein overexpression.

Product Description

Polyclonal Antibody against Human SPATA33


Alternative Gene Names

  • C16orf55
  • FLJ31606

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein spermatogenesis associated 33
Target Gene SPATA33
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SVPKSKEKLMEKHSQEARQADRESEKPVDSLHPGAGTAKHPPPAASLEEKPDVKQKSSRKK
Verified Species Reactivity Human
Interspecies Identity Mouse (51%), Rat (49%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet (Sodium Azide)


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.