
1 / 2
Atlas Antibodies Anti-SPAG8 Antibody
상품 한눈에 보기
인간 SPAG8 단백질을 인식하는 폴리클로날 항체로, 정자 관련 항원 연구에 적합합니다. IHC를 통한 단백질 발현의 정교한 Orthogonal 검증을 지원하며, Rabbit 유래 IgG 형식으로 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SPAG8 Antibody
Target: sperm associated antigen 8
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SPAG8
Alternative Gene Names
BS-84, CILD28, CT142, HSD-1, hSMP-1, SPAG3
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | sperm associated antigen 8 |
| Target Gene | SPAG8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000066196 (48%), Rat ENSRNOG00000032539 (34%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Antigen Sequence
PGSGPGHGSGSHPGPASGPGPDTGPDSELSPCIPPGFRNLVADRVPNYTSWSQHCPWEPQKQPPWEFLQVLEPGARGLWKP제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SPAG7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPAG7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPAG8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPAG4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SPAG17 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.