CacheBy
Atlas Antibodies Anti-SP4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SP4 Antibody

상품 한눈에 보기

인간 SP4 전사인자에 대한 폴리클로날 항체로, IHC 및 ICC 적용에 적합. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 높은 종 간 항원 서열 일치도(인간, 쥐, 생쥐 100%)를 보유. 안정적 PBS/glycerol 버퍼에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040395-100 Anti-SP4 Antibody, Sp4 transcription factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040395-25 Anti-SP4 Antibody, Sp4 transcription factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SP4 Antibody

Anti-SP4 Antibody

Target Information

  • Target Protein: Sp4 transcription factor
  • Target Gene: SP4
  • Alternative Gene Names: HF1B, MGC130008, MGC130009, SPR-1
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SP4 transcription factor.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    NQATGQQQIIIDPSQGLVQLQNQPQQLELVTTQLAGNAWQLVASTPPASKENNVSQP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000005472): 100%
  • Mouse (ENSMUSG00000025323): 100%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative.
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.