CacheBy
Atlas Antibodies Anti-SP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SP1 Antibody

상품 한눈에 보기

Human SP1 전사인자를 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보입니다. 40% 글리세롤과 PBS 완충액에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001853-100 Anti-SP1 Antibody, Sp1 transcription factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001853-25 Anti-SP1 Antibody, Sp1 transcription factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SP1 Antibody

Anti-SP1 Antibody

Sp1 Transcription Factor

  • Immunohistochemistry (IHC)
  • Western Blot (WB, Independent validation)
  • Immunocytochemistry (ICC)

Validation of protein expression in WB:
Independent antibodies targeting different epitopes of the protein were compared for validation.


Product Description

Polyclonal antibody against Human SP1.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Sp1 transcription factor
Target Gene SP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000014084 (95%), Mouse ENSMUSG00000001280 (93%)

Antigen Sequence:
QVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCP


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
Application IHC
Application WB Independent
Independent Validation Tooltip
Application ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.