CacheBy
Atlas Antibodies Anti-SORL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SORL1 Antibody

상품 한눈에 보기

인간 SORL1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity 정제 방식으로 높은 특이성과 재현성을 제공합니다. IHC 등 다양한 응용에 적합하며, PBS/glycerol buffer로 안정화되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031321-100 Anti-SORL1 Antibody, sortilin-related receptor, L(DLR class) A repeats containing 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031321-25 Anti-SORL1 Antibody, sortilin-related receptor, L(DLR class) A repeats containing 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SORL1 Antibody

Anti-SORL1 Antibody

Target: sortilin-related receptor, L(DLR class) A repeats containing
Product Type: Polyclonal Antibody against Human SORL1

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody targeting human SORL1 (sortilin-related receptor, L(DLR class) A repeats containing).

Alternative Gene Names

C11orf32, gp250, LR11, LRP9, SorLA, SorLA-1

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein sortilin-related receptor, L(DLR class) A repeats containing
Target Gene SORL1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMS

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000049313 99%
Rat ENSRNOG00000031814 32%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.