
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SORL1 Antibody
상품 한눈에 보기
인간 SORL1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity 정제 방식으로 높은 특이성과 재현성을 제공합니다. IHC 등 다양한 응용에 적합하며, PBS/glycerol buffer로 안정화되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031321-100 Anti-SORL1 Antibody, sortilin-related receptor, L(DLR class) A repeats containing 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031321-25 Anti-SORL1 Antibody, sortilin-related receptor, L(DLR class) A repeats containing 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SORL1 Antibody
Anti-SORL1 Antibody
Target: sortilin-related receptor, L(DLR class) A repeats containing
Product Type: Polyclonal Antibody against Human SORL1
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody targeting human SORL1 (sortilin-related receptor, L(DLR class) A repeats containing).
Alternative Gene Names
C11orf32, gp250, LR11, LRP9, SorLA, SorLA-1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | sortilin-related receptor, L(DLR class) A repeats containing |
| Target Gene | SORL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMS |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000049313 | 99% |
| Rat | ENSRNOG00000031814 | 32% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



