Atlas Antibodies Anti-SNRPA Antibody

상품 한눈에 보기

Human SNRPA 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Rabbit에서 생산된 IgG 항체이며 PrEST 항원으로 친화 정제되었습니다. Human에 대한 반응성이 검증되어 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046440-100 Anti-SNRPA Antibody, small nuclear ribonucleoprotein polypeptide A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046440-25 Anti-SNRPA Antibody, small nuclear ribonucleoprotein polypeptide A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: small nuclear ribonucleoprotein polypeptide A (SNRPA)

Polyclonal antibody against Human SNRPA.

Mud1, U1-A, U1A

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
IIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMP
```

Verified Species: Human
Interspecies Identity:
- Rat ENSRNOG00000001501 (95%)
- Mouse ENSMUSG00000061479 (92%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.
MSDS	Material Safety Data Sheet