CacheBy
Atlas Antibodies Anti-SNAPC5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNAPC5 Antibody

상품 한눈에 보기

Human SNAPC5 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 높은 특이성과 재현성을 제공하며, 보존제로 sodium azide를 포함함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA024379-100 Anti-SNAPC5 Antibody, small nuclear RNA activating complex, polypeptide 5, 19kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024379-25 Anti-SNAPC5 Antibody, small nuclear RNA activating complex, polypeptide 5, 19kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNAPC5 Antibody

Anti-SNAPC5 Antibody

Target: small nuclear RNA activating complex, polypeptide 5 (19 kDa)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SNAPC5.

Alternative Gene Names

  • SNAP19

Open Datasheet (PDF)

Target Information

  • Target Protein: small nuclear RNA activating complex, polypeptide 5, 19 kDa
  • Target Gene: SNAPC5

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MLSRLQELRKEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSHDMLVHVDNEASINQTTLELSTKSHVTEEEEEEEEEESDS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000010156): 79%
  • Mouse (ENSMUSG00000032398): 78%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.