CacheBy
Atlas Antibodies Anti-SNAPC5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNAPC5 Antibody

상품 한눈에 보기

Human SNAPC5 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 높은 특이성과 재현성을 제공하며, 보존제로 sodium azide를 포함함.

카탈로그번호
HPA024379-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024379-100 Anti-SNAPC5 Antibody, small nuclear RNA activating complex, polypeptide 5, 19kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024379-25 Anti-SNAPC5 Antibody, small nuclear RNA activating complex, polypeptide 5, 19kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNAPC5 Antibody

Anti-SNAPC5 Antibody

Target: small nuclear RNA activating complex, polypeptide 5 (19 kDa)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SNAPC5.

Alternative Gene Names

  • SNAP19

Open Datasheet (PDF)

Target Information

  • Target Protein: small nuclear RNA activating complex, polypeptide 5, 19 kDa
  • Target Gene: SNAPC5

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MLSRLQELRKEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSHDMLVHVDNEASINQTTLELSTKSHVTEEEEEEEEEESDS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000010156): 79%
  • Mouse (ENSMUSG00000032398): 78%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.