CacheBy
Atlas Antibodies Anti-SNAPC3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SNAPC3 Antibody

상품 한눈에 보기

인간 SNAPC3 단백질을 인식하는 토끼 유래 폴리클로날 항체. 면역형광 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 확보. 인간, 생쥐, 랫드 간 높은 서열 유사성 확인.

카탈로그번호
HPA053145-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053145-100 Anti-SNAPC3 Antibody, small nuclear RNA activating complex, polypeptide 3, 50kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053145-25 Anti-SNAPC3 Antibody, small nuclear RNA activating complex, polypeptide 3, 50kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SNAPC3 Antibody

Anti-SNAPC3 Antibody

Target: small nuclear RNA activating complex, polypeptide 3 (50 kDa)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SNAPC3 protein.


Alternative Gene Names

MGC132011, MGC33124, PTFbeta, SNAP50

Open Datasheet (PDF)


Target Information

  • Protein: small nuclear RNA activating complex, polypeptide 3 (50 kDa)
  • Gene: SNAPC3

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

FPYLYCHQGDCEHVIVITDIRLVHHDDCLDRTLYPLLIKKHWLWTRKCFVCKMYTARWVTNNDSFAPEDPCFFCDVCFRMLHYDSEGNKLGEFLAYPYVDPGTFN

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000028483): 97%
  • Rat (ENSRNOG00000010825): 97%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.