AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SMURF2 Antibody
상품 한눈에 보기
인간 SMURF2 단백질을 인식하는 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 토끼에서 생산된 IgG 형식으로 PrEST 항원으로 정제됨. 인간에 특이적이며 쥐와 생쥐에서도 높은 상동성 보임.
- 카탈로그번호
- HPA071508-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA071508-100 Anti-SMURF2 Antibody, SMAD specific E3 ubiquitin protein ligase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071508-25 Anti-SMURF2 Antibody, SMAD specific E3 ubiquitin protein ligase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SMURF2 Antibody
Anti-SMURF2 Antibody
SMAD specific E3 ubiquitin protein ligase 2
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human SMURF2.
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SMAD specific E3 ubiquitin protein ligase 2 |
| Target Gene | SMURF2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPD |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Ortholog Identity | Rat ENSRNOG00000014623 (98%), Mouse ENSMUSG00000018363 (96%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.