CacheBy
Atlas Antibodies Anti-SMC3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SMC3 Antibody

상품 한눈에 보기

Human SMC3 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다. 고순도 및 높은 종간 특이성을 제공합니다.

카탈로그번호
HPA043206-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043206-100 Anti-SMC3 Antibody, structural maintenance of chromosomes 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043206-25 Anti-SMC3 Antibody, structural maintenance of chromosomes 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SMC3 Antibody

Anti-SMC3 Antibody

Target Information

  • Target Protein: Structural maintenance of chromosomes 3
  • Target Gene: SMC3
  • Alternative Gene Names: BAM, bamacan, CSPG6, HCAP, SMC3L1
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human SMC3.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
EFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000024974, 100%)
  • Rat (ENSRNOG00000014173, 100%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

Open Datasheet (PDF)
Material Safety Data Sheet

제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.