
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SMC3 Antibody
상품 한눈에 보기
Human SMC3 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다. 고순도 및 높은 종간 특이성을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA043206-100 Anti-SMC3 Antibody, structural maintenance of chromosomes 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043206-25 Anti-SMC3 Antibody, structural maintenance of chromosomes 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SMC3 Antibody
Anti-SMC3 Antibody
Target Information
- Target Protein: Structural maintenance of chromosomes 3
- Target Gene: SMC3
- Alternative Gene Names: BAM, bamacan, CSPG6, HCAP, SMC3L1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human SMC3.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
EFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSHRG
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000024974, 100%)
- Rat (ENSRNOG00000014173, 100%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
Open Datasheet (PDF)
Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



