Atlas Antibodies Anti-SLX1A Antibody

상품 한눈에 보기

Human SLX1A 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, 연구용으로 권장됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047038-100 Anti-SLX1A Antibody, SLX1 homolog A, structure-specific endonuclease subunit 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047038-25 Anti-SLX1A Antibody, SLX1 homolog A, structure-specific endonuclease subunit 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: SLX1 homolog A, structure-specific endonuclease subunit
Type: Polyclonal Antibody against Human SLX1A

Polyclonal antibody raised in rabbit against Human SLX1A.

항목	내용
Target Protein	SLX1 homolog A, structure-specific endonuclease subunit
Target Gene	SLX1A
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	PGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET
Verified Species Reactivity	Human
Interspecies Identity	Mouse (79%), Rat (77%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet