CacheBy
Atlas Antibodies Anti-SLFN12L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLFN12L Antibody

상품 한눈에 보기

Human SLFN12L 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 40% 글리세롤 및 PBS 완충액에 보존 처리됨.

카탈로그번호
HPA024447-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024447-100 Anti-SLFN12L Antibody, schlafen family member 12-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024447-25 Anti-SLFN12L Antibody, schlafen family member 12-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLFN12L Antibody

Anti-SLFN12L Antibody

Target: schlafen family member 12-like (SLFN12L)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human SLFN12L protein.
Recommended for use in immunohistochemistry and related applications.

Open Datasheet


Target Information

  • Target Protein: schlafen family member 12-like
  • Target Gene: SLFN12L
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NRVKQLTEKEWIQFMVDSEPVCEELPSPASTSSPVSQSYPLREYINFKIQPLRYHLPGLSEKITCAPKTFCRNLFSQHEGLK

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog Gene ID Sequence Identity
Rat ENSRNOG00000006384 30%
Mouse ENSMUSG00000082101 29%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.