
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SLC9A3R2 Antibody
상품 한눈에 보기
Human SLC9A3R2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 단백질 발현 분석에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 사람, 생쥐, 랫드 간 교차 반응성 확인됨.
- 카탈로그번호
- HPA001672-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001672-100 Anti-SLC9A3R2 Antibody, solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001672-25 Anti-SLC9A3R2 Antibody, solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC9A3R2 Antibody
Anti-SLC9A3R2 Antibody
Target: solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human SLC9A3R2.
Alternative Gene Names
E3KARP, NHERF-2, SIP-1, TKA-1
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2 |
| Target Gene | SLC9A3R2 |
| Antigen Sequence | RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLH |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000002504 (87%), Rat ENSRNOG00000002997 (87%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



