Atlas Antibodies Anti-SLC9A3R2 Antibody

상품 한눈에 보기

Human SLC9A3R2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 단백질 발현 분석에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 사람, 생쥐, 랫드 간 교차 반응성 확인됨.

카탈로그번호: HPA001672-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA001672-100 Anti-SLC9A3R2 Antibody, solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA001672-25 Anti-SLC9A3R2 Antibody, solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SLC9A3R2 Antibody

Anti-SLC9A3R2 Antibody

Target: solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human SLC9A3R2.

Alternative Gene Names

E3KARP, NHERF-2, SIP-1, TKA-1

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2
Target Gene	SLC9A3R2
Antigen Sequence	RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLH
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000002504 (87%), Rat ENSRNOG00000002997 (87%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand