
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-FIBP Antibody
상품 한눈에 보기
인간 FIBP 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 재조합 단백질 기반 검증 완료. 토끼 유래 IgG 항체로 높은 특이성과 재현성을 제공. 친화정제 방식으로 고순도 확보.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA011729-100 Anti-FIBP Antibody, fibroblast growth factor (acidic) intracellular binding protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011729-25 Anti-FIBP Antibody, fibroblast growth factor (acidic) intracellular binding protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FIBP Antibody
Anti-FIBP Antibody
Target: fibroblast growth factor (acidic) intracellular binding protein
Type: Polyclonal Antibody against Human FIBP
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, recombinant expression validation)
- Recombinant expression validation in WB using target protein overexpression.
- Immunocytochemistry (ICC)
Alternative Gene Names
- FGFIBP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | fibroblast growth factor (acidic) intracellular binding protein |
| Target Gene | FIBP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (97%), Rat (97%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



