Atlas Antibodies Anti-FIBP Antibody

상품 한눈에 보기

인간 FIBP 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 재조합 단백질 기반 검증 완료. 토끼 유래 IgG 항체로 높은 특이성과 재현성을 제공. 친화정제 방식으로 고순도 확보.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA011729-100 Anti-FIBP Antibody, fibroblast growth factor (acidic) intracellular binding protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA011729-25 Anti-FIBP Antibody, fibroblast growth factor (acidic) intracellular binding protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: fibroblast growth factor (acidic) intracellular binding protein
Type: Polyclonal Antibody against Human FIBP

Immunohistochemistry (IHC)
Western Blot (WB, recombinant expression validation)
- Recombinant expression validation in WB using target protein overexpression.
Immunocytochemistry (ICC)

항목	내용
Target Protein	fibroblast growth factor (acidic) intracellular binding protein
Target Gene	FIBP
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	VRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSL
Verified Species Reactivity	Human
Interspecies Identity	Mouse (97%), Rat (97%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.