CacheBy
Atlas Antibodies Anti-FH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FH Antibody

상품 한눈에 보기

인간 FH 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Fumarate hydratase 단백질 발현 검증에 사용되며, 높은 종간 반응성과 신뢰성 있는 정제 공정을 거쳤습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027341-100 Anti-FH Antibody, fumarate hydratase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027341-25 Anti-FH Antibody, fumarate hydratase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FH Antibody

Anti-FH Antibody

Target: Fumarate hydratase (FH)
Type: Polyclonal Antibody against Human FH


  • Immunohistochemistry (IHC)
  • Western Blot (WB, validated by independent antibodies targeting different epitopes)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human fumarate hydratase (FH), also known as fumarase.


Alternative Gene Names

  • Fumarase

Target Information

항목 내용
Target Protein Fumarate hydratase
Target Gene FH
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
DASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPK
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Rat ENSRNOG00000003653 (100%)
Mouse ENSMUSG00000026526 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative). Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.