AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-FGF9 Antibody
상품 한눈에 보기
인간 FGF9 단백질을 인식하는 토끼 폴리클로날 항체. IHC 검증 완료 및 RNA-seq 데이터 기반 정교한 발현 비교 검증. PrEST 항원으로 친화 정제된 고품질 항체로 다양한 연구 응용에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA067007-100 Anti-FGF9 Antibody, fibroblast growth factor 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067007-25 Anti-FGF9 Antibody, fibroblast growth factor 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FGF9 Antibody
Anti-FGF9 Antibody
Target: Fibroblast Growth Factor 9 (FGF9)
Type: Polyclonal Antibody against Human FGF9
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
- Polyclonal antibody raised in rabbit against human FGF9
- Validated for IHC with orthogonal RNA-seq comparison
- Affinity purified using PrEST antigen as affinity ligand
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Fibroblast Growth Factor 9 |
| Target Gene | FGF9 |
| Antigen Sequence | MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILR |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000021974 (98%), Rat ENSRNOG00000011471 (98%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.