CacheBy
Atlas Antibodies Anti-FGF9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FGF9 Antibody

상품 한눈에 보기

인간 FGF9 단백질을 인식하는 토끼 폴리클로날 항체. IHC 검증 완료 및 RNA-seq 데이터 기반 정교한 발현 비교 검증. PrEST 항원으로 친화 정제된 고품질 항체로 다양한 연구 응용에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067007-100 Anti-FGF9 Antibody, fibroblast growth factor 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067007-25 Anti-FGF9 Antibody, fibroblast growth factor 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FGF9 Antibody

Anti-FGF9 Antibody

Target: Fibroblast Growth Factor 9 (FGF9)
Type: Polyclonal Antibody against Human FGF9


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

  • Polyclonal antibody raised in rabbit against human FGF9
  • Validated for IHC with orthogonal RNA-seq comparison
  • Affinity purified using PrEST antigen as affinity ligand

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Fibroblast Growth Factor 9
Target Gene FGF9
Antigen Sequence MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILR
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000021974 (98%), Rat ENSRNOG00000011471 (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Tooltip Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.