CacheBy
Atlas Antibodies Anti-FGF11 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FGF11 Antibody

상품 한눈에 보기

Human FGF11 단백질을 인식하는 rabbit polyclonal 항체로, 면역세포화학(ICC) 등 다양한 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human에 반응하며 Mouse, Rat과 100% 서열 일치성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA075188-100 Anti-FGF11 Antibody, fibroblast growth factor 11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075188-25 Anti-FGF11 Antibody, fibroblast growth factor 11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FGF11 Antibody

Anti-FGF11 Antibody

Target Information

  • Target Protein: Fibroblast Growth Factor 11
  • Target Gene: FGF11
  • Alternative Gene Names: FHF3, FLJ16061, MGC102953, MGC45269

Product Description

Polyclonal antibody against human FGF11. Suitable for various applications including immunocytochemistry (ICC).

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000042826): 100%
  • Rat (ENSRNOG00000014882): 100%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet
Open Datasheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.